Ask a biomedical scientist
✕
Get specialist, research-focused guidance. We’ll reply by email. (For research use only.)
LL-37 10MG
£65.00
In stock
IN STOCK — ships Monday
LL-37 10mg synthetic peptide reference material supplied in lyophilised form for controlled laboratory and analytical research. Verified by HPLC and mass spectrometry with batch-specific documentation.
Free UK Delivery over £100
Certificate of Analysis (COA)
HPLC Tested
99% Purity
Batch & Certificate Verification
Batch: Not assigned
Shipping to United Kingdom (UK): Royal Mail Tracked 24, Royal Mail Guaranteed by 1pm
Add Bacteriostatic Water (Recommended)
In stock
Research Description
LL-37 10MG
LL-37 10mg
LL-37 10mg – Research Reference Material
Research Grade • Lyophilised Form • HPLC and Mass Spectrometry Verified • Batch-Specific Documentation
Overview
Peptiology’s LL-37 10mg is a synthetic human peptide reference material supplied in lyophilised form for controlled laboratory, analytical and biochemical research.
LL-37 is a 37-amino-acid human cathelicidin antimicrobial peptide derived from the human CAMP gene. Its defined sequence and characterised molecular structure make it suitable for laboratory workflows involving peptide identification, molecular characterisation, peptide–membrane interaction studies and investigations of innate immune and cellular responses.
Product Specifications
Product Name: LL-37 10mg
Catalogue Number: Refer to current Peptiology catalogue
Peptide Length: 37 amino acids
Sequence: [LL-37, 37 aa]
Molecular Formula: C₂₀₅H₃₄₀N₆₀O₅₃
Molecular Weight: approximately 4493.3 g/mol
CAS Number: 154947-66-7
Form: Lyophilised solid
Purity: ≥99% where confirmed by the applicable batch COA
Analytical Methods: HPLC and mass spectrometry
The molecular formula, sequence and molecular weight above are supported by established peptide reference documentation and PubChem. The definitive purity, salt form and analytical results for the Peptiology material should always be confirmed against the applicable batch-specific Certificate of Analysis.
Storage and Laboratory Handling
LL-37 is supplied in lyophilised form to support stability during storage and transport.
Store the unopened material according to the conditions specified in the applicable product documentation and batch-specific Certificate of Analysis. Research-grade LL-37 reference materials are commonly stored at –20°C. Protect the material from excessive heat, moisture and direct light.
Laboratory preparation should be carried out using suitable research-grade materials, appropriate equipment and documented handling procedures.
Once prepared for laboratory analysis, storage conditions should be determined according to the validated requirements of the relevant research protocol.
Synthesis and Quality Assurance
Our LL-37 is supplied as a synthetic peptide reference material with quality-assurance procedures designed to support:
High sequence fidelity
Consistent molecular identity
Reliable batch-to-batch specifications
Traceable analytical documentation
Reproducible research material
Each batch is assessed using applicable analytical techniques such as HPLC and mass spectrometry. A batch-specific Certificate of Analysis is available to support analytical transparency and traceability.
Research Applications
LL-37 is widely investigated in laboratory research involving:
Peptide identification and characterisation
Innate immune response research
Antimicrobial peptide studies
Peptide–membrane interaction research
Host–pathogen interaction models
Cellular signalling investigations
Molecular and biochemical analysis
Analytical assay development
LL-37 is characterised as a human cathelicidin and has been extensively studied for its interactions with biological membranes and its role in innate immune research. These descriptions relate to laboratory and preclinical research contexts and should not be interpreted as claims of therapeutic efficacy or established clinical use.
Why Choose Peptiology?
Peptiology specialises in high-purity laboratory research materials, offering:
Direct manufacturer relationships
Transparent and traceable sourcing
Independent analytical verification
Batch-specific quality documentation
Fast-tracked UK and international dispatch
Responsive researcher support
Our products are supplied to laboratories, universities, biotechnology organisations and research professionals requiring dependable specifications and consistent analytical quality.
Important Notice
For laboratory research and in-vitro use only.
This material is not intended for human or animal use, household use, food use or any form of personal application. It is supplied solely as a laboratory reference material for appropriately controlled research environments.
Product specifications, purity, molecular identity, salt form, storage conditions and analytical results should always be verified against the current batch-specific Certificate of Analysis and product documentation.
Reconstitution & Handling
- Recommended solvent Refer to COA / product notes
- Storage Store as directed in documentation
Important reconstitution notice:
Unless the product page, COA, or batch-specific documentation states otherwise, Peptiology peptide products should only be reconstituted using bacteriostatic water supplied by Peptiology.
Peptides are chemically sensitive materials, and reconstitution behaviour can be influenced by the exact diluent used. Different diluents may vary in pH, ionic strength, preservative content, buffering capacity, osmolarity, dissolved gases, and trace impurities. Even small differences in these factors can affect how a peptide dissolves and behaves in solution.
From a chemistry perspective, pH is especially important because it can alter the ionisation state of acidic and basic amino acid side chains. This can change the peptide’s net charge, hydrogen bonding, electrostatic interactions, and hydrophobic association. If the local pH environment is unsuitable, the peptide may show cloudiness, floating particles, clumping, gel-like behaviour, aggregation, or precipitation.
Bacteriostatic water, sterile water, saline, acetic acid water, and buffered solvent systems are not chemically identical. Substituting one for another may change the peptide’s solubility profile, particularly for longer sequences, hydrophobic peptides, modified peptides, or peptides with specific salt forms.
For consistency, reproducibility, and batch comparability, only the recommended diluent system should be used unless an alternative solvent is specifically stated in the product documentation.
Peptides are chemically sensitive materials, and reconstitution behaviour can be influenced by the exact diluent used. Different diluents may vary in pH, ionic strength, preservative content, buffering capacity, osmolarity, dissolved gases, and trace impurities. Even small differences in these factors can affect how a peptide dissolves and behaves in solution.
From a chemistry perspective, pH is especially important because it can alter the ionisation state of acidic and basic amino acid side chains. This can change the peptide’s net charge, hydrogen bonding, electrostatic interactions, and hydrophobic association. If the local pH environment is unsuitable, the peptide may show cloudiness, floating particles, clumping, gel-like behaviour, aggregation, or precipitation.
Bacteriostatic water, sterile water, saline, acetic acid water, and buffered solvent systems are not chemically identical. Substituting one for another may change the peptide’s solubility profile, particularly for longer sequences, hydrophobic peptides, modified peptides, or peptides with specific salt forms.
For consistency, reproducibility, and batch comparability, only the recommended diluent system should be used unless an alternative solvent is specifically stated in the product documentation.
- Do not substitute diluents unless specifically instructed.
- Only use Peptiology-supplied bacteriostatic water unless stated otherwise.
- Do not assume all peptides behave the same after reconstitution.
- Visible changes may be caused by diluent incompatibility, pH shift, ionic effects, concentration effects, or peptide-specific solubility behaviour.
- Peptiology cannot verify reconstitution compatibility where non-Peptiology diluents have been used.
For laboratory research use only.
Not for human or veterinary use.
Documentation
Batch verification
Live Certificate of Analysis
View the live batch-specific certificate, including purity, batch number, test date, reviewer details, and QR verification.
Specifications
- Categories Peptide Research, Peptides
Peptiology Research Intelligence
Scientific research profile
Illustrative amino-acid residue chain. Colours identify residue type; this is not an experimentally determined tertiary structure.
Molecular class
Formula
Molecular weight
Receptor / molecular target
Cellular signalling cascade
Amino-acid / molecular sequence
Research profile
Primary pathway
Study systems
Key finding
Evidence landscape
Areas of research
Research deep dive
Mechanistic interpretation
What experiments show
Important limitations
Extended scientific review
Molecular mechanism
Experimental models & readouts
Translational evidence
Open research questions
Published research & literature explorer
Research-use information only.
Mechanistic summaries describe published experimental findings and do not constitute dosing, diagnostic or clinical-use guidance. Where no validated receptor has been identified, the page says so rather than assigning a speculative target.
Reviews (0)
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.